PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13046_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 166aa    MW: 19046.1 Da    PI: 10.4449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13046_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.42.1e-203784148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WTteEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
  cra_locus_13046_iso_1_len_903_ver_3 37 KGPWTTEEDQKLVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 84
                                         79********************************************97 PP

2Myb_DNA-binding54.52.6e-1790135148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++++eE++ +++++  lG++ W++Ia  ++ gRt++++k++w+++l
  cra_locus_13046_iso_1_len_903_ver_3  90 RGKFSQEEEQTILHLHSILGNK-WSAIATNLP-GRTDNEIKNFWNTHL 135
                                          89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-262887IPR009057Homeodomain-like
PROSITE profilePS5129424.6123288IPR017930Myb domain
SuperFamilySSF466892.89E-3234131IPR009057Homeodomain-like
SMARTSM007171.7E-153686IPR001005SANT/Myb domain
PfamPF002491.9E-183784IPR001005SANT/Myb domain
CDDcd001672.80E-113984No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2588136IPR009057Homeodomain-like
PROSITE profilePS5129419.4889139IPR017930Myb domain
SMARTSM007175.1E-1589137IPR001005SANT/Myb domain
PfamPF002493.4E-1690135IPR001005SANT/Myb domain
CDDcd001675.47E-1192135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
XAGGVANRSK LKLLPKKETL VAEMGRSPCC DENGLKKGPW TTEEDQKLVD YIQKHGHGSW  60
RALPKLAGLN RCGKSCRLRW TNYLRPDIKR GKFSQEEEQT ILHLHSILGN KWSAIATNLP  120
GRTDNEIKNF WNTHLXXXXX XXXXXXXXXX XXXXXXXXXX XGFKRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29351355104B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790391.12e-77PREDICTED: myb-related protein 315-like
SwissprotQ7XBH42e-63MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A068TYQ92e-77A0A068TYQ9_COFCA; Uncharacterized protein
STRINGVIT_18s0001g05670.t011e-76(Vitis vinifera)